Anti-KCNG4 antibody
| Name | Anti-KCNG4 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85403 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 143-192 (QEELAYWGIEEAHLERCCLRKLLRKLEELEELAKLHREDVLRQQRETRR P) of Human KCNG4 (NP_758857) |
| Description | Rabbit Polyclonal |
| Gene | KCNG4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-KCNG4 antibody (ab85403) at 1 µg/ml + 721_B Cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1: 50,000