Anti-KCNV2 antibody
| Name | Anti-KCNV2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85595 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region from N terminal amino acids 36-85 ( RSGSQASIHGWTEGNYNYYIEEDEDGEEEDQWKDDLAEEDQQAGEVTTAK ) of Human KCNV2 (NP_598004) |
| Description | Rabbit Polyclonal |
| Gene | KCNV2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-KCNV2 antibody (ab85595) at 1 µg/ml (in 5% skim milk / PBS buffer) + 293T Cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution