Anti-KIAA1024 antibody
| Name | Anti-KIAA1024 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab82753 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Horse, Guinea Pig, Bovine, Dog |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 755-804 (DNKDWHRKSKEADRQYDIPPQHRLPKQPKDGFLVEQVFSPHPYPASLKA H) of Human KIAA1024 (NP_056021) |
| Description | Rabbit Polyclonal |
| Gene | KIAA1024 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-KIAA1024 antibody (ab82753) at 1 µg/ml + Fetal brain lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution