Anti-KIF15 antibody
| Name | Anti-KIF15 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab90735 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Bovine, Cat, Dog, Pig |
| Antigen | A synthetic peptide corresponding to a region within internal sequence amino acids 1080 - 1129 ( KKHSGLLQSAQEELTKKEALIQELQHKLNQKKEEVEQKKNEYNFKMRQLE ) of Human KIF15 (NP_064627) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | KIF15 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-KIF15 antibody (ab90735) at 1 µg/ml (in 5% skim milk / PBS buffer) + COLO205 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution