Anti-Kinectin 1 antibody
| Name | Anti-Kinectin 1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab84110 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 972-1021 (EELLKVISEREKEISGLWNELDSLKDAVEHQRKKNNDLREKNWEAMEAL A) of Human Kinectin 1 (NP_001072990) |
| Description | Rabbit Polyclonal |
| Gene | KTN1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Kinectin 1 antibody (ab84110) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal brain lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution