Anti-KIRREL2 antibody
| Name | Anti-KIRREL2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab83014 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 71-120 (WSRYWISGNAANGQHDLHIRPVELEDEASYECQATQAGLRSRPAQLHVL V) of Human KIRREL2, (NP_115499) |
| Description | Rabbit Polyclonal |
| Gene | KIRREL2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-KIRREL2 antibody (ab83014) at 1 µg/ml + Fetal liver lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution