Anti-KLHDC5 antibody
| Name | Anti-KLHDC5 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab87184 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within amino acids 396-445 (VGGCLHELGPNRRSSQSEDMLTVQSYNTVTRQWLYLKENTSKSGLNLTC A) of Human KLHDC5 (NP_065833) |
| Description | Rabbit Polyclonal |
| Gene | KLHL42 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-KLHDC5 antibody (ab87184) at 1 µg/ml + Transfected 293T cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution