Anti-KLHDC8B antibody
| Name | Anti-KLHDC8B antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81060 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide within residues GCAMAEGSVFSLGGLQQPGPHNFYSRPHFVNTVEMFDLEHGSWTKLPRSL corresponding to amino acids 215-264 of human KLHDC8B (NP_775817) |
| Description | Rabbit Polyclonal |
| Gene | KLHDC8B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-KLHDC8B antibody (ab81060) at 1 µg/ml (in 5% skim milk / PBS buffer) + Jurkat cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution