Name | Anti-KLHDC8B antibody |
---|---|
Supplier | Abcam |
Catalog | ab81060 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
Antigen | Synthetic peptide within residues GCAMAEGSVFSLGGLQQPGPHNFYSRPHFVNTVEMFDLEHGSWTKLPRSL corresponding to amino acids 215-264 of human KLHDC8B (NP_775817) |
Description | Rabbit Polyclonal |
Gene | KLHDC8B |
Conjugate | Unconjugated |
Supplier Page | Shop |