Anti-KRCC1 antibody

Name Anti-KRCC1 antibody
Supplier Abcam
Catalog ab105862
Prices $370.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide corresponding to a region within N-terminal amino acids 35-84 ( KMKGDYLETCGYKGEVNSRPTYRMFDQRLPSETIQTYPRSCNIPQTVENR ) of Human KRCC1 (NP_057702)
Description Rabbit Polyclonal
Gene KRCC1
Conjugate Unconjugated
Supplier Page Shop