Anti-KRTAP24-1 antibody
| Name | Anti-KRTAP24-1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab87217 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rat, Horse, Cat |
| Antigen | Synthetic peptide corresponding to a region within the internal amino acids 205-254 (VRNYHYSSYRPTSCRPLSYLSRSFRSLSYIPSTFPPLRYLCSGSRPLKC Y) of human KRTAP24-1 (NP_001078924) |
| Description | Rabbit Polyclonal |
| Gene | KRTAP24-1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-KRTAP24-1 antibody (ab87217) at 1 µg/ml + 293T cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution