Name | Anti-KRTAP24-1 antibody |
---|---|
Supplier | Abcam |
Catalog | ab87217 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Rat, Horse, Cat |
Antigen | Synthetic peptide corresponding to a region within the internal amino acids 205-254 (VRNYHYSSYRPTSCRPLSYLSRSFRSLSYIPSTFPPLRYLCSGSRPLKC Y) of human KRTAP24-1 (NP_001078924) |
Description | Rabbit Polyclonal |
Gene | KRTAP24-1 |
Conjugate | Unconjugated |
Supplier Page | Shop |