Anti-Kv2.1 antibody
| Name | Anti-Kv2.1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86513 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rat, Horse, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 755-804 (IDADTDDEGQLLYSVDSSPPKSLPGSTSPKFSTGTRSEKNHFESSPLPT S) of Human KCNB1 (NP_004966) |
| Description | Rabbit Polyclonal |
| Gene | KCNB1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Kv2.1 antibody (ab86513) at 1 µg/ml + HepG2 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution