Anti-LAIR1 antibody

Name Anti-LAIR1 antibody
Supplier Abcam
Catalog ab133844
Prices $370.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide corresponding to a region within C terminal amino acids 180-229 ( LLVLFCLHRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGL ) of Human LAIR1
Description Rabbit Polyclonal
Gene LAIR1
Conjugate Unconjugated
Supplier Page Shop

Product images