Anti-LBX1 antibody
| Name | Anti-LBX1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab90839 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Zebrafish, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig, Xenopus |
| Antigen | Synthetic peptide corresponding to a region of Human LBX1 within internal sequence amino acids 72-121 ( PLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQT ) (NP_006553) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | LBX1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
