Anti-LCN12 antibody
| Name | Anti-LCN12 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85430 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | A synthetic peptide corresponding to a region within the N terminal amino acids 36-85 ( GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG ) of Human LCN12, NP_848631 |
| Description | Rabbit Polyclonal |
| Gene | LCN12 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-LCN12 antibody (ab85430) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal heart lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution