Anti-LDHAL6A antibody
| Name | Anti-LDHAL6A antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab123086 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Bovine, Cat, Pig, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 185-234 (CHGLILGEHGDSSVPVWSGVNIAGVPLKDLNPDIGTDKDPEQWENVHKK V) of Human LDHAL6A (NP_659409) |
| Description | Rabbit Polyclonal |
| Gene | LDHAL6A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-LDHAL6A antibody (ab123086) at 1 µg/ml + HepG2 cell lysate at 10 µg