Name | Anti-LDHAL6A antibody |
---|---|
Supplier | Abcam |
Catalog | ab123086 |
Prices | $359.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Bovine, Cat, Pig, Zebrafish |
Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 185-234 (CHGLILGEHGDSSVPVWSGVNIAGVPLKDLNPDIGTDKDPEQWENVHKK V) of Human LDHAL6A (NP_659409) |
Description | Rabbit Polyclonal |
Gene | LDHAL6A |
Conjugate | Unconjugated |
Supplier Page | Shop |