Anti-LDHD antibody
| Name | Anti-LDHD antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab87741 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 432 - 481 ( LVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEVG ) of Human LDHD (NP_705690) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | LDHD |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-LDHD antibody (ab87741) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal heart lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution