Anti-Leukotriene A4 hydrolase antibody
| Name | Anti-Leukotriene A4 hydrolase antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86760 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide from within a region of internal sequence amino acids 467-516 (ACIALSQRWITAKEDDLNSFNATDLKDLSSHQLNEFLAQTLQRAPLPLG H) of Human Leukotriene A4 hydrolase (NP_000886) |
| Description | Rabbit Polyclonal |
| Gene | LTA4H |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Leukotriene A4 hydrolase antibody (ab86760) at 1 µg/ml (5% skim milk/ PBS buffer) + 293T cell lysate at 10 µg with gel concentration: 12%SecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution