Anti-LIF antibody
| Name | Anti-LIF antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab104705 |
| Prices | $376.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Sheep, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within amino acids 2-51( KVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQ ) of Human LIF according to NP_002300 |
| Description | Rabbit Polyclonal |
| Gene | LIF |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-LIF antibody (ab104705) at 1 µg/ml + Active human LIF full length protein (ab57665) at 0.01 µgSecondaryGoat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilutiondeveloped using the ECL techniquePerformed under reducing conditions.Exposure time : 8 minutes
Anti-LIF antibody (ab104705) at 1 µg/ml + Human Fetal Muscle Lysate at 10 µg