Anti-LILRA4 antibody
| Name | Anti-LILRA4 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab133846 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 420-469 ( ATETLNPAQKKSDSKTAPHLQDYTVENLIRMGVAGLVLLFLGILLFEAQH ) of Human LILRA4 (NP_036408) |
| Description | Rabbit Polyclonal |
| Gene | LILRA4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-LILRA4 antibody (ab133846) at 1 µg/ml + 721_B cell lysate at 10 µg