Anti-LILRB2 antibody
| Name | Anti-LILRB2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab128349 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 547-596 ( MDTRAAASEAPQDVTYAQLHSLTLRRKATEPPPSQEREPPAEPSIYATLA ) of Human LILRB2 (NP_005865) |
| Description | Rabbit Polyclonal |
| Gene | LILRB2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-LILRB2 antibody (ab128349) at 1 µg/ml + Human fetal brain lysate at 10 µg