Anti-LINGO4 antibody
| Name | Anti-LINGO4 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab84662 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Guinea Pig, Bovine, Cat, Pig |
| Antigen | Synthetic peptide corresponding to a region within amino acids 468-517 (TLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNI T) of human LINGO4 (NP_001004432) |
| Description | Rabbit Polyclonal |
| Gene | LINGO4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-LINGO4 antibody (ab84662) at 1 µg/ml (in 5% skim milk / PBS buffer) + 293T cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution