Anti-LIPC antibody
| Name | Anti-LIPC antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab123088 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 303-352 (GDMNSFSQGLCLSCKKGRCNTLGYHVRQEPRSKSKRLFLVTRAQSPFKV Y) of Human LIPC (NP_000227) |
| Description | Rabbit Polyclonal |
| Gene | LIPC |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-LIPC antibody (ab123088) at 1 µg/ml + Human fetal liver lysate at 10 µg