Anti-LRRC52 antibody
| Name | Anti-LRRC52 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab105423 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rat, Rabbit, Bovine, Cat, Pig |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids QEVICTGKQLTEYPLDIPLNTRRLFLNENRITSLPAMHLGLLSDLVYLDC of Human LRRC52 (NP_001005214) |
| Description | Rabbit Polyclonal |
| Gene | LRRC52 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-LRRC52 antibody (ab105423) at 1 µg/ml + PANC-1 cell lysate at 10 µg