Anti-LRRN4CL antibody
| Name | Anti-LRRN4CL antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98199 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Bovine, Cat |
| Antigen | Synthetic peptide corresponding to internal sequence amino acids 107-156 ( PFSPVLHYWLLLWDGSEAAQKGPPLNATVRRAELKGLKPGGIYVVCVVAA ) of Human LRRN4CL (NP_981967) |
| Description | Rabbit Polyclonal |
| Gene | LRRN4CL |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-LRRN4CL antibody (ab98199) at 1 µg/ml (in 5% skim milk / PBS buffer) + 721_B cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution