Anti-LRRTM1 antibody

Name Anti-LRRTM1 antibody
Supplier Abcam
Catalog ab87774
Prices $370.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human, Mouse, Rat, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish
Antigen Synthetic peptide corresponding to a region within internal amino acids 180 - 229 ( IFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNDLVKVNFAHF ) of Human LRRTM1 (NP_849161) Run BLAST with Run BLAST with
Description Rabbit Polyclonal
Gene LRRTM1
Conjugate Unconjugated
Supplier Page Shop

Product images