Name | Anti-LRRTM1 antibody |
---|---|
Supplier | Abcam |
Catalog | ab87774 |
Prices | $370.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
Antigen | Synthetic peptide corresponding to a region within internal amino acids 180 - 229 ( IFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNDLVKVNFAHF ) of Human LRRTM1 (NP_849161) Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | LRRTM1 |
Conjugate | Unconjugated |
Supplier Page | Shop |