Anti-LYSMD4 antibody

Name Anti-LYSMD4 antibody
Supplier Abcam
Catalog ab87162
Prices $370.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide corresponding to a region within N terminal amino acids 36-85 ( RREQVTWCCCSGSWPRRTASTSWRCSMAANTFYFRPNGAGDTRQNLIPDF ) of Human LYSMD4 (NP_689662)
Description Rabbit Polyclonal
Gene LYSMD4
Conjugate Unconjugated
Supplier Page Shop

Product images