Name | Anti-Manic Fringe antibody |
---|---|
Supplier | Abcam |
Catalog | ab104708 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Cat, Dog, Chimpanzee |
Antigen | Synthetic peptide corresponding to a region within amino acids 211-260 ( MAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETL ) of Human Manic Fringe (NP_002396) |
Description | Rabbit Polyclonal |
Gene | MFNG |
Conjugate | Unconjugated |
Supplier Page | Shop |