Anti-Manic Fringe antibody

Name Anti-Manic Fringe antibody
Supplier Abcam
Catalog ab104708
Prices $370.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Cat, Dog, Chimpanzee
Antigen Synthetic peptide corresponding to a region within amino acids 211-260 ( MAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETL ) of Human Manic Fringe (NP_002396)
Description Rabbit Polyclonal
Gene MFNG
Conjugate Unconjugated
Supplier Page Shop

Product images