Anti-MAP3K8 antibody
| Name | Anti-MAP3K8 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab94899 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Horse |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 36-85 ( SEEPAVYEPSLMTMCQDSNQNDERSKSLLLSGQEVPWLSSVRYGTVEDLL ) of Human MAP3K8 (NP_005195) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | MAP3K8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-MAP3K8 antibody (ab94899) at 1 µg/ml + THP-1 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution