Anti-MATN1 antibody
| Name | Anti-MATN1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab97937 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 359 - 408 ( KYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFA ) of Human MATN1 (NP_002370) |
| Description | Rabbit Polyclonal |
| Gene | MATN1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-MATN1 antibody (ab97937) at 1 µg/ml (in 5% skim milk/ PBS buffer) + OVCAR3 cell lysate at 10 µgSecondaryHRP-conjugated anti-Rabbit IgG at 1/50000 dilution