Anti-MBD3L1 antibody - C-terminal
| Name | Anti-MBD3L1 antibody - C-terminal |
|---|---|
| Supplier | Abcam |
| Catalog | ab135354 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Horse, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 144-193 ( CKQFLVTEEDIRKQEGKVKTVRERLAIALIADGLANEAEKVRDQEGRPEK ) of Human MBD3L1 |
| Description | Rabbit Polyclonal |
| Gene | MBD3L1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-MBD3L1 antibody - C-terminal (ab135354) at 1 µg/ml + HT100 cell lysate at 10 µg