Anti-MED31 antibody - ChIP Grade
| Name | Anti-MED31 antibody - ChIP Grade |
|---|---|
| Supplier | Abcam |
| Catalog | ab98142 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ChIP |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 1-50 (MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFV N) of Human MED31 (NP_057144) |
| Description | Rabbit Polyclonal |
| Gene | MED31 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30 minutes) or (0, 30, 60 minutes) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.
Anti-MED31 antibody - ChIP Grade (ab98142) at 1 µg/ml (5% skim milk / PBS buffer) + Human fetal liver lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG diluted 1/50,000