Name | Anti-MEPE antibody |
---|---|
Supplier | Abcam |
Catalog | ab108073 |
Prices | $359.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Cat, Dog |
Antigen | Synthetic peptide corresponding to a region within middle amino acids 350-399 (LPGREGNRVDAGSQNAHQGKVEFHYPPAPSKEKRKEGSSDAAESTNYNE I) of Human MEPE (NP_064588) |
Description | Rabbit Polyclonal |
Gene | MEPE |
Conjugate | Unconjugated |
Supplier Page | Shop |