Anti-MEPE antibody
| Name | Anti-MEPE antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab108073 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within middle amino acids 350-399 (LPGREGNRVDAGSQNAHQGKVEFHYPPAPSKEKRKEGSSDAAESTNYNE I) of Human MEPE (NP_064588) |
| Description | Rabbit Polyclonal |
| Gene | MEPE |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-MEPE antibody (ab108073) at 1 µg/ml + HeLa cell lysate at 10 µg