Anti-Metabotropic Glutamate Receptor 6 antibody
| Name | Anti-Metabotropic Glutamate Receptor 6 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab90866 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Pig, Chimpanzee, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 360-409 ( FWEENFNCKLTSSGTQSDDSTRKCTGEERIGRDSTYEQEGKVQFVIDAVY ) of Human Metabotropic Glutamate Receptor 6 (NP_000834) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | GRM6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Metabotropic Glutamate Receptor 6 antibody (ab90866) at 1 µg/ml + Human fetal small intestine lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution