Name | Anti-Metabotropic Glutamate Receptor 6 antibody |
---|---|
Supplier | Abcam |
Catalog | ab90866 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Pig, Chimpanzee, Zebrafish |
Antigen | Synthetic peptide corresponding to a region within internal amino acids 360-409 ( FWEENFNCKLTSSGTQSDDSTRKCTGEERIGRDSTYEQEGKVQFVIDAVY ) of Human Metabotropic Glutamate Receptor 6 (NP_000834) Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | GRM6 |
Conjugate | Unconjugated |
Supplier Page | Shop |