Anti-Methyltransferase-like protein 10 antibody
| Name | Anti-Methyltransferase-like protein 10 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab122963 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat, Rabbit, Guinea Pig, Cat, Dog, Human |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 151-200 (VDKGTYDAISLNPDNAIEKRKQYVMSLSRVLEVKGFFLITSCNWTKAEL L) of Mouse Methyltransferase-like protein 10 (NP_082371) |
| Description | Rabbit Polyclonal |
| Gene | METTL10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Methyltransferase-like protein 10 antibody (ab122963) at 1 µg/ml + Mouse spleen lysate at 10 µg