Anti-MGC35062 antibody
| Name | Anti-MGC35062 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab90021 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rabbit, Horse, Guinea Pig, Dog, Pig, Yeast |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 144-193 ( ANMLKSEMKSMEHDSSQLNELQKQKSELIQELFTLQRKLKVFEDEENESI ) of Human MGC35062 (NP_940917) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | CCDC172 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-MGC35062 antibody (ab90021) at 1 µg/ml + Human placenta lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution