Name | Anti-MGC70863 antibody |
---|---|
Supplier | Abcam |
Catalog | ab94911 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Sheep, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 2-51 ( SLTFRRPKTLRLRRQPRYPRKSTPRRNKLGHYAIIKFPLATESAVKKIEE ) of Human MGC70863 (NP_976047) Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | RPL23AP82 |
Conjugate | Unconjugated |
Supplier Page | Shop |