Anti-Motilin antibody
| Name | Anti-Motilin antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98874 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 35-84 (LQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPL E) of Human Motilin (NP_002409) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | MLN |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Motilin antibody (ab98874) at 1 µg/ml + HT1080 cell lysate at 10 µg