Anti-Motilin receptor antibody
| Name | Anti-Motilin receptor antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab133749 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 348-397 ( ASINPILYNLISKKYRAAAFKLLLARKSRPRGFHRSRDTAGEVAGDTGGD ) of Human Motilin receptor (NP_001498) |
| Description | Rabbit Polyclonal |
| Gene | MLNR |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Motilin receptor antibody (ab133749) at 1 µg/ml + HeLa cell lysate at 10 µg