Anti-MPP7 antibody
| Name | Anti-MPP7 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab87216 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 2-51 ( PALSTGSGSDTGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSLV ) of Human MPP7 (NP_775767) |
| Description | Rabbit Polyclonal |
| Gene | MPP7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-MPP7 antibody (ab87216) at 1 µg/ml (in 5% skim milk / PBS buffer) + HT1080 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution