Name | Anti-MRPL10 antibody |
---|---|
Supplier | Abcam |
Catalog | ab84897 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rabbit, Pig |
Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 35-84 ( HRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPSPPSPPQEEIGLIRLLRRE ) of Human MRPL10 (NP_660298) Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | MRPL10 |
Conjugate | Unconjugated |
Supplier Page | Shop |