Anti-MRPL10 antibody
| Name | Anti-MRPL10 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab84897 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rabbit, Pig |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 35-84 ( HRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPSPPSPPQEEIGLIRLLRRE ) of Human MRPL10 (NP_660298) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | MRPL10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-MRPL10 antibody (ab84897) at 1 µg/ml + Jurkat Cell Lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution