Name | Anti-MRPL15 antibody |
---|---|
Supplier | Abcam |
Catalog | ab90167 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 36-85 ( PERRPRGRRRGRKCGRGHKGERQRGTRPRLGFEGGQTPFYIRIPKYGFNE ) of Human MRPL15 (NP_054894) |
Description | Rabbit Polyclonal |
Gene | MRPL15 |
Conjugate | Unconjugated |
Supplier Page | Shop |