Anti-MRPL45 antibody
| Name | Anti-MRPL45 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab113786 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 256-305 ( YGSWRMHTKIVPPWAPPKQPILKTVMIPGPQLKPEEEYEEAQGEAQKPQL ) of Human MRPL45 (NP 115727) |
| Description | Rabbit Polyclonal |
| Gene | MRPL45 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-MRPL45 antibody (ab113786) at 1 µg/ml + Human fetal heart lysate at 10 µg