Name | Anti-MRPL45 antibody |
---|---|
Supplier | Abcam |
Catalog | ab113786 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 256-305 ( YGSWRMHTKIVPPWAPPKQPILKTVMIPGPQLKPEEEYEEAQGEAQKPQL ) of Human MRPL45 (NP 115727) |
Description | Rabbit Polyclonal |
Gene | MRPL45 |
Conjugate | Unconjugated |
Supplier Page | Shop |