Anti-MRPL48 antibody
| Name | Anti-MRPL48 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98163 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 71-120 (KKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAESYAQYVHNLCNSLSI K) of Human MRPL48 (NP_057139) |
| Description | Rabbit Polyclonal |
| Gene | MRPL48 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-MRPL48 antibody (ab98163) at 1 µg/ml + Jurkat cell lysate at 10 µg