Anti-MS4A14 antibody
| Name | Anti-MS4A14 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab90010 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 576 - 625 ( YPEGQSKDGQVKDQQTDKEQNSKKQTQDQQTEDQPAQEKKSPKGQFQNVQ ) of Human MS4A14 (NP_115986) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | MS4A14 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-MS4A14 antibody (ab90010) at 1 µg/ml (in 5% skim milk / PBS buffer) + PANC1 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution