Anti-MTA3 antibody
| Name | Anti-MTA3 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab87275 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC-P |
| Species Reactivities | Human, Chimpanzee, Monkey, Orangutan |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 400-450 ( CRLCAICWLYWKKYGGLKMPTQSEEEKLSPSPTTEDPRVRSHVSRQAMQG M ) of Human MTA3 (Swiss-Prot entry Q9BTC8, GeneID 57504) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | MTA3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
ab87275 at 1/250 dilution staining MTA3 in Human breast carcinoma by Immunohistochemistry Formalin-fixed, Paraffin-embedded tissue. Detection: DAB staining
ab87275 at 1/250 dilution staining MTA3 in Human seminoma by Immunohistochemistry Formalin-fixed, Paraffin-embedded tissue. Detection: DAB staining
Anti-MTA3 antibody (ab87275) at 1/2000 dilution + Human trophoblast cell lysate at 10 µgSecondaryHRP-conjugated donkey anti-rabbit polyclonal IgG at 1/5000 dilutiondeveloped using the ECL technique