Anti-MTMR12 antibody

Name Anti-MTMR12 antibody
Supplier Abcam
Catalog ab94444
Prices $370.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish
Antigen Synthetic peptide corresponding to a region within internal sequence amino acids 540 - 589 ( LYVEKPKLDKGQRKGMRFKHQRQLSLPLTQSKSSPKRGFFREETDHLIKN ) of Human MTMR12 (NP_001035536) Run BLAST with Run BLAST with
Description Rabbit Polyclonal
Gene MTMR12
Conjugate Unconjugated
Supplier Page Shop

Product images