Name | Anti-MTMR12 antibody |
---|---|
Supplier | Abcam |
Catalog | ab94444 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 540 - 589 ( LYVEKPKLDKGQRKGMRFKHQRQLSLPLTQSKSSPKRGFFREETDHLIKN ) of Human MTMR12 (NP_001035536) Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | MTMR12 |
Conjugate | Unconjugated |
Supplier Page | Shop |