Anti-MYBPH antibody
| Name | Anti-MYBPH antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98187 |
| Prices | $378.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Immunomicroscopy |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 107-156, LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP , of Human MYBPH (NP_004988) |
| Description | Rabbit Polyclonal |
| Gene | MYBPH |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-MYBPH antibody (ab98187) at 1 µg/ml (n 5% skim milk / PBS buffer) + HeLa Cell Lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution