| Name | Anti-Myosin Phosphatase antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab24670 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IP |
| Species Reactivities | Mouse, Dog, Human |
| Antigen | Synthetic peptide: MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKF , corresponding to N terminal amino acids 1-38 of the large, non-catalytic subunit of myosin phosphatase |
| Description | Rabbit Polyclonal |
| Gene | PPP1R12A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Lu Y, Zhang H, Gokina N, Mandala M, Sato O, Ikebe M, Osol G, Fisher SA. Am J Physiol Cell Physiol. 2008 Feb;294(2):C564-71. Epub 2007 Dec 19.
Parra M, Mahmoudi T, Verdin E. Genes Dev. 2007 Mar 15;21(6):638-43.