Anti-Neurogranin antibody
| Name | Anti-Neurogranin antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab125316 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Rat, Mouse, Rabbit, Goat, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Human |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 6-55 ( ESACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGECGRKG ) of Rat Neurogranin (NP_077054) |
| Description | Rabbit Polyclonal |
| Gene | NRGN |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Neurogranin antibody (ab125316) at 1 µg/ml + Rat brain lysate at 10 µg