Anti-NFAT2 antibody
| Name | Anti-NFAT2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98173 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 755-804 (STLMPAAPGVSPKLHDLSPAAYTKGVASPGHCHLGLPQPAGEAPAVQDV P) of Human NFAT2 (NP_006153) |
| Description | Rabbit Polyclonal |
| Gene | NFATC1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-NFAT2 antibody (ab98173) at 1 µg/ml (5% skim milk / PBS buffer) + NCI-H226 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution